PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016448851.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 218aa    MW: 24826.1 Da    PI: 9.085
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016448851.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF58.67.5e-191354142
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                    k+i+n+  r+vtfskRr g++KKA EL++L +ae+a+++ s 
  XP_016448851.1 13 KPIDNQNSRHVTFSKRRLGLFKKATELCILSGAEIAILVQSL 54
                    68*************************************984 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006620.423553IPR002100Transcription factor, MADS-box
SMARTSM004327.8E-23565IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-21677IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-11727IPR002100Transcription factor, MADS-box
PfamPF003196.8E-181562IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-112742IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MKKTQGRRKI AIKPIDNQNS RHVTFSKRRL GLFKKATELC ILSGAEIAIL VQSLKRQRLF  60
AFGHPNADAV IDRYLTGKSS SSSSIVDKLN VQQNNQYYSQ SCRELEAEKK KKEIIENSKI  120
VNNNNNNEGF WWNESFDYMR IEELEEIMGA LEELKKKITM RADELSMING SSVLPSNSTM  180
NSNIARFGAE DQFSNQAAID YCSSIVPYQF NHPGDGQF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016448851.11e-162PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLK4B2N71e-112K4B2N7_SOLLC; Uncharacterized protein
STRINGSolyc01g106700.2.11e-112(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21342252
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.14e-23AGAMOUS-like 62